Kênh Tên Miền chuyên cung cấp tên miền đẹp, giá rẻ! Hãy liên hệ kỹ thuật: 0914205579 - Kinh doanh: 0912191357 để được tư vấn, hướng dẫn miễn phí, Cảm ơn quý khách đã ủng hộ trong thời gian qua!
Saturday, July 6, 2013

Bài học Viết chính tả Từ vựng 1
beardcreaseeavesheaveleap
kneehavefranksmackclamp
build
Nhấp chuột để Thực hành Danh sách Viết chính tả 1


Bài học Viết chính tả Từ vựng 2
builtsquintlivestickcliff
bronzebuzzsnatchdredgechurch
palm
Nhấp chuột để Thực hành Danh sách Viết chính tả 2


Bài học Viết chính tả Từ vựng 3
calfhalftalkwalkchalk
lawnfaultspawndriftfund
verse
Nhấp chuột để Thực hành Danh sách Viết chính tả 3


Bài học Viết chính tả Từ vựng 4
searchfernservewereherb
strengthsneakpurseclutchwitch
Nhấp chuột để Thực hành Danh sách Viết chính tả 4


Bài học Viết chính tả Từ vựng 5
scriptguessstartwrathfloor
czarhaunchflaunthauntsharp
kneel
Nhấp chuột để Thực hành Danh sách Viết chính tả 5


Bài học Viết chính tả Từ vựng 6
elopementexponentheroicdetachmentdogmatic
dramaticecstaticelasticinducementacumen
allurementamusement
Nhấp chuột để Thực hành Danh sách Viết chính tả 6


Bài học Viết chính tả Từ vựng 7
establishfanaticfantasticgiganticinhabit
abusiveperusalpursuantrefusal
attendantintestatecompensate
Nhấp chuột để Thực hành Danh sách Viết chính tả 7


Bài học Viết chính tả Từ vựng 8
afloatbelowbemoanbestowdeplore
abreastaheadbefriendbeheldpostpone
Nhấp chuột để Thực hành Danh sách Viết chính tả 8


Bài học Viết chính tả Từ vựng 9
deportremoteattemptdistressconnect
deflectdiluteensueimbueabridge
Nhấp chuột để Thực hành Danh sách Viết chính tả 9


Bài học Viết chính tả Từ vựng 10
dismissamidstbewitchrecruitrecluse
refuteeclipseextinctforgiveinflict
Nhấp chuột để Thực hành Danh sách Viết chính tả 10


Trường thanh của các Nguyên âm.
Bài học Viết chính tả Từ vựng 11
austererevereawrybeguiledeprive
decreaseincreaserepealdescribedespise
prescribedecline
Nhấp chuột để Thực hành Danh sách Viết chính tả 11


Bài học Viết chính tả Từ vựng 12
appealappearappeaseacquireassign
demisecomprisediscreetextremeimpeach
disguiseigniteinquire
Nhấp chuột để Thực hành Danh sách Viết chính tả 12


Các từ đọc nhấn mạnh ở âm tiết áp chót.
Bài học Viết chính tả Từ vựng 13
amendedangelicappendixassemblyassessment
parentalpoeticpresentedpreventivecontented
reflective
Nhấp chuột để Thực hành Danh sách Viết chính tả 13


Bài học Viết chính tả Từ vựng 14
decrepitdefendantrefreshingreplenishresentment
surrenderdilemmadistemperdomesticembellish
embezzleredundantconcurrent
Nhấp chuột để Thực hành Danh sách Viết chính tả 14


Các từ ba âm tiết gồm đoản thanh của các nguyên âm.
Bài học Viết chính tả Từ vựng 15
acquittalbewildercommitmentconsiderabolish
abhorrentadmonishallotmentdeliverdiminish
Nhấp chuột để Thực hành Danh sách Viết chính tả 15


Bài học Viết chính tả Từ vựng 16
consistentcontingentenigmademolishinsipid
intrinsicmalignantpacificprohibitembody
harmonic
Nhấp chuột để Thực hành Danh sách Viết chính tả 16


Nguyên âm trong âm tiết cuối cùng câm.
Bài học Viết chính tả Từ vựng 17
bacontokenbrazenhavenhazel
maidenmasonravenshakentaken
Nhấp chuột để Thực hành Danh sách Viết chính tả 17


Bài học Viết chính tả Từ vựng 18
wakenspokendeaconsweetentreason
weakenweaselheightenlightenripen
Nhấp chuột để Thực hành Danh sách Viết chính tả 18


Bài học Viết chính tả Từ vựng 19
tightenwidenbrokenclovenfrozen
goldenfattenhappenravelsadden
Nhấp chuột để Thực hành Danh sách Viết chính tả 19


Bài học Viết chính tả Từ vựng 20
reddenfreshenopenleavenlengthen
reckonbittendrivenkittenprison
Nhấp chuột để Thực hành Danh sách Viết chính tả 20


Bài học Viết chính tả Từ vựng 21
quickenrisensmittenstiffenswivel
writtenfastenglistendrunkenmutton
Nhấp chuột để Thực hành Danh sách Viết chính tả 21


Nguyên âm trong âm tiết cuối cùng không câm.
Bài học Viết chính tả Từ vựng 22
crayondemonsiphoncolonomen
barrelparcelaspencabindragon
gravelbeveltalon
Nhấp chuột để Thực hành Danh sách Viết chính tả 22


Bài học Viết chính tả Từ vựng 23
wagonsuddenfelonlemonmelon
channelchickencitronkitchenmitten
pistonheronflannel
Nhấp chuột để Thực hành Danh sách Viết chính tả 23


Các từ hai âm tiết gồm trường thanh của các nguyên âm.
Bài học Viết chính tả Từ vựng 24
aguechaosdailydaisybeaver
drearyeagermeannessfamousfailure
faithfulneatlyclearance
Nhấp chuột để Thực hành Danh sách Viết chính tả 24


Bài học Viết chính tả Từ vựng 25
credencefleecygreedyfracasnamesake
measlespeoplelegionregionsteeple
highlandtreatiestreatmenttweezersweary
Nhấp chuột để Thực hành Danh sách Viết chính tả 25


Các từ kết thúc với ow, chữ cái cuối cùng được phát âm câm.
Bài học Viết chính tả Từ vựng 26
arrowharrownarrowmarrowsparrow
sallowtallowshallowshadowelbow
fellowmellowfallowmeadowbillow
windowwinnowwidowborrow
Nhấp chuột để Thực hành Danh sách Viết chính tả 26


Các từ bao gồm ei hoặc ie, được sắp xếp ngẫu nhiên.
Bài học Viết chính tả Từ vựng 27
grievethievepiecedsheikretrieve
apiececonceitbelievebesiegedeceive
reliefrelievedeceiverdeceitfulachieving
receiver
Nhấp chuột để Thực hành Danh sách Viết chính tả 27


Bài học Viết chính tả Từ vựng 28
cleverpainterwaywarddigestlightning
portraitnoviceTuesdayclimatescaffold
Nhấp chuột để Thực hành Danh sách Viết chính tả 28


Bài học Viết chính tả Từ vựng 29
shamblestranscriptmenaceshepherdwholesome
shriveljostlebuttonpicnicgrumble
Nhấp chuột để Thực hành Danh sách Viết chính tả 29


Bài học Viết chính tả Từ vựng 30
hustlerumbletroublearguesarcasm
tarnishtartarharanguerelapseprofess
revengeflighty

0 comments:

Post a Comment

domain, domain name, premium domain name for sales

Popular Posts