Kênh Tên Miền chuyên cung cấp tên miền đẹp, giá rẻ! Hãy liên hệ kỹ thuật: 0914205579 - Kinh doanh: 0912191357 để được tư vấn, hướng dẫn miễn phí, Cảm ơn quý khách đã ủng hộ trong thời gian qua!
Saturday, July 6, 2013

Bài học Viết chính tả Từ vựng 1
educateebonyeffigyelephantembassy
admiralagonyalcoholamnestyemery
felony
Nhấp chuột để Thực hành Danh sách Viết chính tả 1


Bài học Viết chính tả Từ vựng 2
federalcannibalfactorygallerymanual
parasolsentinelresidentmyriadslippery
tyrannysymphony
Nhấp chuột để Thực hành Danh sách Viết chính tả 2


Bài học Viết chính tả Từ vựng 3
mulberrymuscularpunishmentsubsequentamplify
gratifypacifysanctifycultivatejustify
multiplymultitude
Nhấp chuột để Thực hành Danh sách Viết chính tả 3


Bài học Viết chính tả Từ vựng 4
substitutepantomimeradicalpatronizesatellite
ancestryCalvarycavalrymarigoldbattery
canopycharitymajesty
Nhấp chuột để Thực hành Danh sách Viết chính tả 4


Các âm O và U.
Bài học Viết chính tả Từ vựng 5
condordoctrinefossilfrostywonder
wondrousworrysolidlozengeoffice
olivenovelmovementstuccobuzzard
Nhấp chuột để Thực hành Danh sách Viết chính tả 5


Bài học Viết chính tả Từ vựng 6
orangeostrichpompouspromisecustard
flourishhundredhusbandjockeymotley
bucklebustledungeonluncheon
Nhấp chuột để Thực hành Danh sách Viết chính tả 6


Đoản thanh của các Nguyên âm.
Bài học Viết chính tả Từ vựng 7
doubleknucklenourishsouthernfrustrate
reptilesentenceskepticspecklebedstead
cherub
Nhấp chuột để Thực hành Danh sách Viết chính tả 7


Bài học Viết chính tả Từ vựng 8
crescentcrevicesterilevestigewedlock
Wednesdayzealousessenceethicsfeather
brimstone
Nhấp chuột để Thực hành Danh sách Viết chính tả 8


Bài học Viết chính tả Từ vựng 9
dictatefrigatepillagetributefender
heavyheiferjealousjellyadjunct
daggerbramblecallous
Nhấp chuột để Thực hành Danh sách Viết chính tả 9


Bài học Viết chính tả Từ vựng 10
concealcongealrefrainremainrestrain
retainretailabsolvedissolveresolve
respond
Nhấp chuột để Thực hành Danh sách Viết chính tả 10


Bài học Viết chính tả Từ vựng 11
reprintrestrictresistsubmitdistinct
begrudgeconvulsereproachencroachpatrol
Nhấp chuột để Thực hành Danh sách Viết chính tả 11


Bài học Viết chính tả Từ vựng 12
parolebeforeindulgerepulsesuccumb
affrontamongretakeretracerepay
delayallay
Nhấp chuột để Thực hành Danh sách Viết chính tả 12


Bài học Viết chính tả Từ vựng 13
agilefashiongalleybitternbrisket
chimneychiselknapsackladderlattice
Nhấp chuột để Thực hành Danh sách Viết chính tả 13


Bài học Viết chính tả Từ vựng 14
crystaldistancedwindlepicklepassive
practicerabidtacticscrimsongriddle
Nhấp chuột để Thực hành Danh sách Viết chính tả 14


Bài học Viết chính tả Từ vựng 15
livelonggypsyhitherbiscuitfilbert
imageimpulsemildewkidneylintel
liquidliquor
Nhấp chuột để Thực hành Danh sách Viết chính tả 15


Bài học Viết chính tả Từ vựng 16
juicystewardjewelneutralcorner
forfeitgorgeousbolstercourtshipcocoa
morbid
Nhấp chuột để Thực hành Danh sách Viết chính tả 16


Bài học Viết chính tả Từ vựng 17
mortgagemorselcertainsurlysurgeon
earnestjournalauditcausticawkward
gaudy
Nhấp chuột để Thực hành Danh sách Viết chính tả 17


Bài học Viết chính tả Từ vựng 18
laureldrizzletickletwinklethimble
villainsodasofasobertopaz
Nhấp chuột để Thực hành Danh sách Viết chính tả 18


Bài học Viết chính tả Từ vựng 19
balustradealkalialkalineapogeeasterisk
azimuthbachelorfabricategalaxymastodon
Nhấp chuột để Thực hành Danh sách Viết chính tả 19


Bài học Viết chính tả Từ vựng 20
mackerelmarinerparagraphparaphrasebeverage
democratdenizendensityedifyemanate
emphasizeepicure
Nhấp chuột để Thực hành Danh sách Viết chính tả 20


Bài học Viết chính tả Từ vựng 21
sphericalsynonymwildernesswhimsicalcurrency
subsidysubterfugeconjugateconsecratecoronet
dominant
Nhấp chuột để Thực hành Danh sách Viết chính tả 21


Bài học Viết chính tả Từ vựng 22
arbitratearmamentarmisticearchitectarchery
barbarismdecimaldespotismemphasisepitaph
carnivalcarbonategardener
Nhấp chuột để Thực hành Danh sách Viết chính tả 22


Bài học Viết chính tả Từ vựng 23
metaphoreditorsenatorspecimenspeculate
formulaorderlyordinalorphanagecriticism
cylindermysterymystifyphysicaltypify
Nhấp chuột để Thực hành Danh sách Viết chính tả 23


Đoản thanh và Trường thanh của các nguyên âm.
Bài học Viết chính tả Từ vựng 24
butlerjudgmentcottageforagehostage
prostratecommondogmadolphinhostile
Nhấp chuột để Thực hành Danh sách Viết chính tả 24


Bài học Viết chính tả Từ vựng 25
modernconventsorreldismaldistrict
mimicmissiveclimaxfibroushybrid
Nhấp chuột để Thực hành Danh sách Viết chính tả 25


Bài học Viết chính tả Từ vựng 26
hyphenblemishelementcherrycredit
embersbailiffbasementbraceletbravely
Nhấp chuột để Thực hành Danh sách Viết chính tả 26


Bài học Viết chính tả Từ vựng 27
alertassertavertconcernavail
awaitdecaydeclaimdefrayprevail
expert
Nhấp chuột để Thực hành Danh sách Viết chính tả 27


Bài học Viết chính tả Từ vựng 28
inertinferinsertinvertprefer
reclaimabstainacquaintaffrayassuage
blockade
Nhấp chuột để Thực hành Danh sách Viết chính tả 28


Bài học Viết chính tả Từ vựng 29
subvertsuperbabsurdrecurdemur
disturbdisplayentailobtaincontain
persuade
Nhấp chuột để Thực hành Danh sách Viết chính tả 29


Bài học Viết chính tả Từ vựng 30
abroadremovealoofballoonbuffoon
befallrecallenthrallresortassort
besought

0 comments:

Post a Comment

domain, domain name, premium domain name for sales

Popular Posts